SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032356
Domain Number 1 Region: 28-82,110-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000387
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Domain Number 2 Region: 175-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032356   Gene: ENSMODG00000023949   Transcript: ENSMODT00000033935
Sequence length 221
Comment pep:novel chromosome:BROADO5:4:356385876:356479438:-1 gene:ENSMODG00000023949 transcript:ENSMODT00000033935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLKLSPSLLLLGAFILEASALEVVNLVDFCGQMLRGEGMIIRSHSDSRKFYFVALETDCW
LTVQAASPQDRILFQFRFFLVYSLTQPSSSELPQITTSGLPSHLREDPCTTGSYVQFYDG
SKEGPHLGKPLCGMTIPGPVLSTGRSLSLRLVTRGQQPRVDFIGDFTSFRLGTLGDYFLC
RNKKCIPQSLVCDVWGIDNCGDGSDQTAYHPASCRGPSPVP
Download sequence
Identical sequences F7A6C2
ENSMODP00000032356 13616.ENSMODP00000032356 ENSMODP00000032356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]