SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032501 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032501
Domain Number 1 Region: 149-303,456-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.47e-51
Family Tandem AAA-ATPase domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1797-1931
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 3.49e-23
Family XPF/Rad1/Mus81 nuclease 0.001
Further Details:      
 
Domain Number 3 Region: 1949-1987
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000213
Family Hef domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032501   Gene: ENSMODG00000007334   Transcript: ENSMODT00000034083
Sequence length 2037
Comment pep:novel chromosome:BROADO5:1:255465118:255567575:-1 gene:ENSMODG00000007334 transcript:ENSMODT00000034083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSRTLFQTWGSRVTRSILSSSEVGSGVGQPQGLVSLGACAPEDVEAPETEPPEADDE
VLLVAVYEAERRPGSGENPVSPEALEDCGFCSGAGAVWIYPTNYPVRDYQLRISEAALFC
NTLVCLPTGLGKTFIAAVVMYNFYRWFPSGKVVFMAPTKPLVAQQIEACSRVMGIPQGHM
AEMTGSTQAFIRKEIWHKKRVLFLTPQVMMNDLSRGACPAVKIKCLVIDEAHKALGNYAY
CQVVRELVKYTKHFRILALSATPGNDTKAVQQVVSNLLIGQIELRSEDSSDILPFTHERR
IEKLVVSLGEELVTIQNTYIQILETFASRLIRVNVLMRQDIPNLTKFQIILARDLFRKKL
SSHILGGQQGIIEGDFAICISLYHGYELLQQMGMRSLYIFLCGIMDGTKSMTRTRNELSR
NEQFMELFELLGKMFSDRHPNQIGPNDKKFIYSHPKLKKLEEVVVEHFRTWKDQNTSEKK
CDTRVMIFSSFRDSVQEIAEMLQKQPEVRVMTFVGHASGKSTKGLTQKEQLEVVKRFRDG
GYNTLVSTCVGEEGLDIGEVDLIICFDAQKSPVRLVQRMGRTGRKREGRIVIILTEGREE
SAYNRSQSCKRSIYKAISGNSKTFHFYQGSPRMIPDGIYPKLHKMFITQEIYEQAKQSKI
CPKSSVNGKKQCNSKKAWSLTEEEFRLWNKLYRLRESDEFNEIVLPKTKFESLQDDDLSN
HESRPGSYQLSLSEWRVWQNCPFPTHQVDHSDRCYHFISIMEMIDQIRNEEDECSYELKL
KPYLQIGDISSTSDVLRNKHASSASVNMTTLQKPSFKRNMKQSCSSSLIEFDEECSQEFK
SNKNFSSKVKTPKEMTKEQLKTNNNDNFSNSLITEVNSVVSCNFSEVPQVAKVSLDIDNV
TNTNTAHGHLCELLVECSPIDKSESSFVRNHVASSYNDFTDGKSISSSIFYLPEDPDLLK
TSPLCDKCFILTKETLNNVERFLSESPPHRDELYNLKDEIIKKSSFKNLQDDMSNYFMST
SFVNPPLCSEINSPKLHSSKSNQLSQINSNRMVDRSSCDEHENEINTCVQNDKRSFGDHT
QINGSPKRYLVKKKTGEVCKTLMKKLGIEQDQERKFSEATDTEFNQVSSPYIKNNSKYLS
VSDEAFTREVVQVSPFRISDECLLDFDSETKIPLIQSTKFGTSFEDIGVSNENFQNDDIF
DCSKELFSVNFDLGFCSPDSDEEDLEQAQDVNKNVHLKVDASGSHVNTTQIATDYGPSKE
SILSTYEKSNIRRSISTPSKLQHHYPNYIFSPLETTKDKEFESPGNSSAASISLPLGENV
MSTPLRTPNPMDLFSTATQEIFDTSTTKKKVNLRGIKKTLSSTFEKVGITMEKADSNEEI
NLFESCHYSDEGNSIGSENDVVFQRKSKKVKRDHLKSPNVGKSSDIESPVCVVKKCRRLL
STSESSSDESIDFHKPVLTQDDFQSNKRNPPKDVRVLKRYRNRKHEGRQFLDEEAEISED
AEGISSDESEKSENEQDSLLVDFLNDGTQLSQVLNDSEMKSVYLQSVRSPLVGNMYKMVH
KKYDSMNIFSQIPEQDESYSGDSFCVSDEEEHPINDSTEEVCIDFSLLNEDSFVDGRKKY
HTRRLAKLKRFNAQNNFAFKKKKVSRIIVPDDSSEEDNIVNVHDKTESAYVIDGSICSKT
EKQNDCLQKALLSGSLKREEDPIKPIAVNNSITEGQKRPLNIKCTVSEALDENSQCDHKI
RSLLNADSLKNCKNFTTQHKVNNDLVDVNSKPTSSSNQNLIMTPTSFELPEKSKRTCILV
DNREISSGSEIISSLRTIHGLEVEVCPLNGCDYIVSNRMAVERKSQSEMVNSMNRCKLIE
KIQYLQNIFERVCVIVEKDREKKGAVSKVFQRTKNYDSLLSALIGAGIRILFSSCQKETA
ELIKELTLVEKRKNVGIHVPVAVKDDKRDIFRFYLSIPNISYVTALNMCHHFSSVKKMTN
SSLEEISLNAQMAFLVHLKIFTLPLFPHLENELEKEMANHSSISAKKTSSGIIKSQK
Download sequence
Identical sequences F7AS38
ENSMODP00000032501 ENSMODP00000032501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]