SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032558 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032558
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Immunoglobulin 4.84e-17
Family V set domains (antibody variable domain-like) 0.0024
Further Details:      
 
Domain Number 2 Region: 123-230
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-17
Family V set domains (antibody variable domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032558   Gene: ENSMODG00000024013   Transcript: ENSMODT00000034142
Sequence length 237
Comment pep:novel chromosome:BROADO5:4:347434995:347439357:-1 gene:ENSMODG00000024013 transcript:ENSMODT00000034142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFVVGSQQIIQTQQGEDIMFSCQLSPNMDARKMTVEWYRGQTLVRSYSKGVKDIKEIEGP
QFQGRTELLKDGMAEGKVTLKIHQAQASDNGIYTCRFQAPDSCMKSYALIKGSTHLEKRK
FFVVGSQQIIQTKLGDDIILSCHLYPNMDARKMTVEWYRGQTLVRSYSKGVKDIKEIEGP
QFQGRTELLKDDMAEGKVTLKIHQAQASDNGIYTCRFQAPDCLNWAYSALPVTGKSH
Download sequence
Identical sequences F6YQ11
13616.ENSMODP00000032558 ENSMODP00000032558 ENSMODP00000032558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]