SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032676 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032676
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-20
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000941
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032676   Gene: ENSMODG00000024036   Transcript: ENSMODT00000034255
Sequence length 204
Comment pep:novel chromosome:BROADO5:3:440745675:440748764:1 gene:ENSMODG00000024036 transcript:ENSMODT00000034255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLSVQCWAVRYPEAIDCSWTTQRETDMNPELDLQASFIATYRLGMITQGETHPCLQPSP
EARSCVIPNIQMFSMIPYILNITVITPQGARSSLVPFIAEHIIKPDPPEAMSVSPSPGKQ
LQVKWKPPHSWPLPKYFPLKYLIRYQRQGATRYRQVGPIEETSFILQGLHPKTQYQVQVA
ARDFLDYGELSTWSTVVATTPGSK
Download sequence
Identical sequences F7D339
ENSMODP00000032676 13616.ENSMODP00000032676 ENSMODP00000032676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]