SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032688 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032688
Domain Number 1 Region: 81-360
Classification Level Classification E-value
Superfamily L domain-like 2.66e-52
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 428-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000142
Family Fibronectin type III 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032688
Domain Number - Region: 35-78
Classification Level Classification E-value
Superfamily L domain-like 0.000476
Family Ngr ectodomain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032688   Gene: ENSMODG00000003513   Transcript: ENSMODT00000034267
Sequence length 661
Comment pep:novel chromosome:BROADO5:1:233521541:233523526:-1 gene:ENSMODG00000003513 transcript:ENSMODT00000034267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLKTTKWPSHRALLLKSWVIISLGLYMQVSKNMACPNVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLSKLKEFSIVRN
SLSHPPPDLPGTHLVKLYLQDNQINHIPLTAFSNLHKLERLDISNNQLRMLAQGVFDNLS
NLKQLTARNNPWFCDCGIKWVTEWLKFIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGFSLMTPPPSVIPPTTQIPTQPAATPSGNSTPLTPTVSKLLPTVPDWDGRERVTP
VVSERILLSVHSVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQDLS
LINLEPKSTYRICLVPLDAFNYRAGEDTVCSEATTHASHLNNGSNSASSHEQTTSHNMGS
PFLLAGLIGGAVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSI
LEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCH
T
Download sequence
Identical sequences F7D2R9
ENSMODP00000032688 XP_007472750.1.35504 XP_016281458.1.35504 XP_016281462.1.35504 XP_016281467.1.35504 XP_016281468.1.35504 XP_016281470.1.35504 ENSMODP00000032688 13616.ENSMODP00000032688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]