SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032937 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032937
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily Immunoglobulin 9.82e-24
Family V set domains (antibody variable domain-like) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032937   Gene: ENSMODG00000024089   Transcript: ENSMODT00000034516
Sequence length 136
Comment pep:novel chromosome:BROADO5:6:283887744:283888151:-1 gene:ENSMODG00000024089 transcript:ENSMODT00000034516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRISSWLPCSLLFFPVGHAALKQPQSSITAYVGTTARVICEVSSSNFANEYIHWYQQKPN
QPLEHLLYVVSTRVPTQKSLDDQKNKFVGEKNNAQSTSVLAINSITHKDEATYYCAIWEY
HSNEHSVTPHTRILPS
Download sequence
Identical sequences F7G5Z2
13616.ENSMODP00000032937 ENSMODP00000032937 ENSMODP00000032937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]