SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033076 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033076
Domain Number 1 Region: 11-177
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-42
Family G proteins 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033076   Gene: ENSMODG00000024105   Transcript: ENSMODT00000034654
Sequence length 194
Comment pep:novel chromosome:BROADO5:4:318748750:318749334:-1 gene:ENSMODG00000024105 transcript:ENSMODT00000034654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLNFRAQHKEEPRVVIMGLDSAGKTTLLYRLKSNQQVETYPTVGFNVESLEASKHGSL
TLWDIGGQDQLRSSWKDYLEDTDSLLYVLDSTDEDRLPEATVELENVLNNAHMVGVPFLV
LANKQEVPGALSLLEIRDRMQLDRFNDRCWELRGCSALTGEGLKEAQLALERLLQSRKQL
CLYTMQVNGERKKS
Download sequence
Identical sequences F6X0M1
13616.ENSMODP00000033076 ENSMODP00000033076 XP_001378595.1.35504 ENSMODP00000033076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]