SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033249 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033249
Domain Number 1 Region: 112-222
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-19
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 
Domain Number 2 Region: 3-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000319
Family V set domains (antibody variable domain-like) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033249   Gene: ENSMODG00000008979   Transcript: ENSMODT00000034826
Sequence length 228
Comment pep:novel chromosome:BROADO5:3:433690826:433722516:-1 gene:ENSMODG00000008979 transcript:ENSMODT00000034826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVIGPTGPIEDSLGGETELSCYLSPSQSAQHMEVFWFQSTWVVYIYIEMGRIILEIRPS
ITKGGQNSITNGNITLKIWDVRFLDAGRYMCFIEDGVHQEEVNMELKVLEQFSVIGPTGP
IQASLGGEAELSCYLSPSQSAQHMEVVWFQSTSIVHVYRNGEDHFGDQALNYQGRTELLK
EAIIHGNITLKIWDVRFLDAGRYMCLIEDGVHQEEANMELKVSGMYGL
Download sequence
Identical sequences F6XZH1
ENSMODP00000033249 13616.ENSMODP00000033249 ENSMODP00000033249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]