SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033648 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033648
Domain Number 1 Region: 983-1117
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-43
Family C-type lectin domain 0.00000539
Further Details:      
 
Domain Number 2 Region: 154-268
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-41
Family Link domain 0.0061
Further Details:      
 
Domain Number 3 Region: 269-382
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-30
Family Link domain 0.0063
Further Details:      
 
Domain Number 4 Region: 1113-1172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 41-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000239
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 6 Region: 946-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000489
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033648   Gene: ENSMODG00000016815   Transcript: ENSMODT00000035229
Sequence length 1203
Comment pep:novel chromosome:BROADO5:2:191610548:191635599:1 gene:ENSMODG00000016815 transcript:ENSMODT00000035229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQMLLLLLTALVQAPTSSSVAFTGDSSEDQAFRVSIGGDSPLRGVLGGSITIPCHISYL
RPPPPTPPPGRRAVLGSPRVKWTFLSGGREAEVLVARGLKVKVSEGYRYRVALPGYPAST
TDVSLVLSELRSNDSGLYRCEVQHGIDDGSDAVEVKVKGVVFLYREGSARYAFSFSRAQE
ACARIGARIASPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNY
GMVDPEDLYDVYCYAEDLNGELFLGSTPEKLTLEEARAYCWERGAEIATTGQLYAAWDEG
LDRCSPGWLADGSVRYPIVTPRQRCGGGLPGVKTLFLFPNQTGFPNAHSRFNVYCFRDPA
HSSVSPRNLYPASDGLETIVTVTETLQEHQLLQEATQSESRGAMYSVPISEDNRGISSTP
EDPEEAPKILLGKSLCLKVLNWRKEEKVIFTHVPVASSSLHLKSNSPTVLYSSVHLPLPI
FLFSLRSLSFQTPFSGALPQSPPFPGPCFQSPTPPLCPTILFPSPHSGPWVPRTPWVLFS
SIALDAVHGTDIAFISPSQILSEIQEVAIENGSLSTEPTREERLSEAPLVAQVSVHHGSV
PPPGRKPEGPKHPRVRGQFTETLTTLGVIAHGEGSQASLPPSRVGVPELSGGTPPWVPHA
ESDEVGSSEEAPGLSPTTGTLPGVEGKEGAGDRVAPPEEALGRTAPVETSVGAQPALPTE
SAGLGAAGAAAPSPGNPTHSSFPVTLLPPALGPVTPLLSLSFHSDTLITPRAAHLFSTPP
PVILFLTPGFMHFLPLPLSSFLESSFCPKPAPSVNPTLPSNCRPLLLSFIPPFSPQFEHH
FSSCLPIHCLFTCLPSLPLCVLPLPFFHLCVPFWMISGKPLDWNPLSVPGNKPFPQGALI
DTTSVKYFYDYTETRTDGHASHLGRCHLGGEVGPQAPCLMSLPLAGDCVPSPCHNGGTCY
EEGDGVHCLCLPGYGGNLCEIGLRSCSSGWDAFQGSCYKHFSTRRSWEEAETQCRLHGAH
LASISTPEEQNFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGE
NCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLALVFGRPRSHYEVDSVLRY
HCQEGLAQRNSPLIRCLENGQWEHPQISCVPKRPPRAQLRRTALKERQAARRAGGCRGTG
GHC
Download sequence
Identical sequences F6VZ19
ENSMODP00000033648 ENSMODP00000033648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]