SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033980 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033980
Domain Number 1 Region: 113-212
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-20
Family Fibronectin type III 0.000073
Further Details:      
 
Domain Number 2 Region: 213-310
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-17
Family Fibronectin type III 0.0000171
Further Details:      
 
Domain Number 3 Region: 33-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000124
Family I set domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033980   Gene: ENSMODG00000017198   Transcript: ENSMODT00000035566
Sequence length 467
Comment pep:novel chromosome:BROADO5:2:188751440:188819512:1 gene:ENSMODG00000017198 transcript:ENSMODT00000035566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSATLGLLAVLFLAFGDGLVPEDCPRLDVPRDILTQVPGAPITLTCLNEELKNNATIRW
TLEDKPIGPQLGQREMVGGKLLLRSVQYSDSGNYTCYVNGSLVRTLPLLVVDPPEEPVLS
CHWKSFVSRIQCEWSPQRKPSPQTEAVLLVRHVQKEAMFQKPCQYLQGSQKFSCPFHLRQ
EDDSLYLVVLCVTNGVMRKVSKAQQFRGYEVLQPDPPTNITVTAVDKKPHRLNVTWKDPP
SWNSTYYRLQFELRYRAEKTKDFTKIMSKDQHSLIISDAWMGKRHVVQIRAQEEFSLGKW
SEWSQEVTGTPWTETKTTTVGTELFISTQAPTTRENCIESLSPENPEGITNTLPGPDSPH
SSYTFLVAGGSLVLGTILFIGIIMRYRKKSKLTALKEGKPNVLPPFSLGQLVSEKPQSTP
VLVPLISPSVSPSSSEPTNAPGHSRKDIVDPPSPYDVTNRDYFFFQK
Download sequence
Identical sequences F6Z3Z1
ENSMODP00000033980 XP_007482055.1.35504 ENSMODP00000033980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]