SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034017 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034017
Domain Number 1 Region: 914-1135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.03e-76
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000994
Further Details:      
 
Domain Number 2 Region: 340-497
Classification Level Classification E-value
Superfamily Fibronectin type III 6.65e-18
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 505-602
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000289
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 212-323
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000622
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 5 Region: 2-77
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 6 Region: 625-766
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000118
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034017   Gene: ENSMODG00000019925   Transcript: ENSMODT00000035603
Sequence length 1226
Comment pep:novel chromosome:BROADO5:5:284949774:284984068:1 gene:ENSMODG00000019925 transcript:ENSMODT00000035603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEPSPVSDIEVVSVGTTEATLTWKNVDKAASQYKYIVEDRGSEMKVITSWHPNVTITDLK
PGTTYTFFIFPEVENRTQGLKEAVNVTTSKILIIHTKEGLRPKIGDPQRWAGGKLGDNQV
LGQSGGEPSNHARGNKKVKDDIALRIWHLGVCQAIITPPSLWVNRKNDPLRDDDNSTDVS
MVDDSLPAAFDPSTSTHKCNLQKIGKLVAEIPGSTRIHITGLNSGTLYQVTVFSQTTNGV
KGDPQIIRFKTNSSQVINFQIVEVSDTGVNLTWENSDNSSSSYTYRIHVAGDGHSFDQNS
NVTHVAITELYSSTLYNFTVYPKRNHDPEGQPAFTQAYTAPHPVSDFRVQSFNTTSIDLA
WSSEASFFRILVKDFMNHSFSHNGTYKEKQLLVTDLIPGTLYHIEIFPQAPDGREGGSQT
LEQTTEPSAISDIEVVSVNTTTIHLKWQNEDSASPGYRYHLLVKQNGSSVFNLTTSSLNK
TIKGLTPGTLYNVTIYPEVGNGTKGSPVSKAVYTRPSPVSTISFSNISTTDVIINWQEPD
IASTDYTYFISLVEGQSISPIPKFINRTSKVRNTTITGLSPGTSYEVIIYSQVGEDALQG
EPVHEFFCTDAASVAFLKCNPVPKQSTLTLRWPCPPGMNRGFNMTIRSGEWSREISLPPC
YSMYLSDDLNGTYVAHLNYSTSYDISLTTLSCGGESFPKWNVCRTSITDPPPPDGLPNIF
PINHNSLKVKFGKFEASHGPITAYAVILTTERSGNKSSVDFLNYTYDDFKKRISKTYVTY
LMNITEDRAASDLSDGLKYEVIVGNESITDGYYNGKLEPLSSYRACIAGFTNITFDSLHP
GLIDGTESYVSFSLYSDPVSLPQNPAVICGAVFGCIFGALVIVAVGGFIFWRRKRKDAKN
SDVSFSQIKPKKSKLIKVENFESYFKKQQADSNCGFAEEYEDLKLIGVNQPKFAAEIPEN
RGKNRYNNVLPYDISRVKLSIQTQVTDDYINANYMPGYYSKKDFIATQGPLPNTLRDFWR
MVWEKNIYSIVMLTKCVEQGRTKCEEYWPSKQTQNYGDITVAMTSEIILPEWTIRDFTVK
NSKTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVNDHMKQSPPECPVLVHCRKLSRV
PGVDGISIGSFAGESVWSSSFMGISFQFNLVWDNDQYVFLNQCVWDIIKSQKDSKADLIY
QNTTAMTIYENLAPMTAFGKTNGYIA
Download sequence
Identical sequences F7GFS5
ENSMODP00000034017 ENSMODP00000034017 13616.ENSMODP00000034017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]