SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034019 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034019
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily L domain-like 4.82e-30
Family Ngr ectodomain-like 0.029
Further Details:      
 
Domain Number 2 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 303-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000255
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034019   Gene: ENSMODG00000024416   Transcript: ENSMODT00000035605
Sequence length 492
Comment pep:novel chromosome:BROADO5:6:235438750:235441051:1 gene:ENSMODG00000024416 transcript:ENSMODT00000035605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLTDIPGNALVGLDSLESLSFYDNKLVTVPQLALQKVPNLKFLDLNKNPIHKIQEGDFR
NMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRNVPALESLML
NNNALNAVYQKTVESLPNLREISIHSNPLRCDCVIHWVNSNKTNIRFMEPLSMFCAMPPE
YRGQQVKEVLIQDSSEQCLPMISHDTFPNHLNMDIGMTVFLDCRAMAEPEPEIYWVTPLG
NKITVETLSDKYKLSNEGTLEITSIQIEDSGRYTCVAQNIEGADTRVATIRVNGTLLDGT
QVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLT
HLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVIS
LASIAVYVAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWDGDSEKDKDGSAETKP
TQVDTSRSYYMW
Download sequence
Identical sequences F7GFS0
ENSMODP00000034019 13616.ENSMODP00000034019 ENSMODP00000034019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]