SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000034028
Domain Number - Region: 31-88
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000909
Family Eukaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034028   Gene: ENSMODG00000024419   Transcript: ENSMODT00000035614
Sequence length 225
Comment pep:novel chromosome:BROADO5:8:204533707:204545276:1 gene:ENSMODG00000024419 transcript:ENSMODT00000035614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFILFALLVGAFYSDHTVKHDKEELVSYPVCIKNHFSPCVGVLIHRQCLLAAAHHYLPR
LKTFMGNFTKRIKDATERTLNSIHMISWNLSTNPSEHKLMVPSTQRVPQGSTYSGSDVDR
SVPGGDNPDLQEDNKALMIIEKKCQKRDLGKVRRKRSCLHFLNPFRRLCVETWKWYWLLS
SAMTRFRSRNVSHFLENNISIYTNIFCYILSIQKFFIKMSYCYVF
Download sequence
Identical sequences F7G5Q8
ENSMODP00000034028 XP_007504525.1.35504 ENSMODP00000034028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]