SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034032 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034032
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.98e-41
Family Eukaryotic proteases 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034032   Gene: ENSMODG00000000003   Transcript: ENSMODT00000035618
Sequence length 238
Comment pep:novel chromosome:BROADO5:8:204471644:204477122:-1 gene:ENSMODG00000000003 transcript:ENSMODT00000035618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSLPPFSLAFLVVSGDKVLHGNEQNDDPAPYLVYIKNQYSPCVGVLIHQQWVLAAAHCY
LPSLKVKLGNFKKRVRDGTEQTIKSVQIIRYWNLTTDSSNHNLMLIKLSKPAVLNEKVQP
MGLPTKSVPAGTKCIISGLDWSIKNNGKHPDLRQTFTAPLLSDKECQKTKQGKGNKNRIC
VKFLKSFNRIFVEAILAAVICKDKIQGIEVGNFLVGDIGVYTNIFNYIPWIQKIMSTR
Download sequence
Identical sequences F7G5G1
ENSMODP00000034032 ENSMODP00000034032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]