SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034052 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034052
Domain Number 1 Region: 660-863
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-34
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 461-660
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-32
Family Fibronectin type III 0.0000786
Further Details:      
 
Domain Number 3 Region: 90-187
Classification Level Classification E-value
Superfamily Immunoglobulin 7.9e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 174-270
Classification Level Classification E-value
Superfamily Immunoglobulin 1.91e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 283-369
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 369-467
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000196
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034052   Gene: ENSMODG00000004153   Transcript: ENSMODT00000035638
Sequence length 1060
Comment pep:novel chromosome:BROADO5:6:230513452:230598367:1 gene:ENSMODG00000004153 transcript:ENSMODT00000035638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIDLQHIPQDERVYMSQKGDLYFANVEENDSRNDYCCFAAFPRLRTIVQKMPMKLTVNS
LKHANDSSSHRQNVTKANVIKQREPRMLLPPETSGSHSSITIIKGGTLLLECFAEGLPTP
QITWKKVGEDLPKGRETQENFGKTLKIEQVTHMDKGHYHCMAKNYKGTAIHEFRVTVEEP
PRWTKKPESAVYSIGSNGILLCEAEGEPAPEIEWKINGLPIDKEHPLPGIVFFPGEISFS
NVQLNHTGVYQCEATNVHGKILATANINVLDIAPLMQTPDDEGYAAVVGYSAFLLCEVFA
SPPAVITWQRPSKVERLEGSHYTTYPNGTLEIKETTKEDAGPYTCWVKSPRGEVAVTAHL
TIRDATNLTVSPLNPHVIRSHLLVLHCDIECDSHLKHSLKLSWSKDGEALEINGTEDVRI
IIDGDKLTISNITLEDEGLYACLANTALDRAMATTQVTILDVPDPPENVYLSERQNRSVR
LSWEAGDNHNSAITEFIIEFEGNRDEPGKWAELTKVQGNETTALLSLAPYVRYQFRVRGV
NAVGRSIPSSPSDYHETPPAAPDKNPENIRVEASQPKEMFIKWEPLNSMEQNGPGLEYRV
TWRQQGVPSEWSDELATDNTLRVMTSSVFTPYDVKVQAINQLGSGPEPQTITVYSGEDYP
DAAPLSVTTRVINSTLINVTWDRIPKERVHGHLKGYQINWWKTKSRLDERKFPKEIQTIR
LPGDRSYGMVPSLDPFSEFKLTVLAYNSKGAGPESSPISFQTPEGVPEQPNFLKVIHVDK
NTVVLSWGLPKKAHGNLTGYSLQYQIINDTDEIGELKEINITNPSKLSWRVPDLNSTTKY
KFYLRACTSKGCGKPVTEEGCTTGEGSKTVGKISEAVNPTQKLHTLEAFDPETEHTVRLV
TKNWVDNNSIFEDVIETRGRAYAGLYDNISTQGWFIGLMCAIALLTLILLTICFVRRNKG
GKYSVKEKEDLHPDPEVQSGKDETFGEYSDSDEKPLKGSLQSLNRDLQATESADSLVDYG
EGDHGLFNEDGSFIGAYTGSKEKGSVESTGSSMATFPLRA
Download sequence
Identical sequences F7FUN9
ENSMODP00000034052 ENSMODP00000034052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]