SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034211 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000034211
Domain Number - Region: 14-185
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000258
Family Hermes transposase-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034211   Gene: ENSMODG00000024452   Transcript: ENSMODT00000035797
Sequence length 192
Comment pep:novel chromosome:BROADO5:3:395639151:395639751:-1 gene:ENSMODG00000024452 transcript:ENSMODT00000035797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLALDKSNVTHDSAQLLIFIHGTTDNFKDTEDLAALQSIKGTITGEDIYEKVSKAVKDL
ELDWAKLASVTTYGSPSMVSSKKGVIARINQEMNKPSHPIAIHCLIHQQALIYPVMKIVV
SCVNFIRANALNHRQYQEFLPELKVAYEDVLYHIEVHWLSRGRVLRHFYDLIPQITALIL
SKNKEVPEFNDA
Download sequence
Identical sequences F6Z8M1
ENSMODP00000034211 13616.ENSMODP00000034211 ENSMODP00000034211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]