SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034226 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034226
Domain Number 1 Region: 17-103
Classification Level Classification E-value
Superfamily Immunoglobulin 2.86e-23
Family V set domains (antibody variable domain-like) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034226   Gene: ENSMODG00000024455   Transcript: ENSMODT00000035812
Sequence length 104
Comment pep:novel chromosome:BROADO5:1:171187249:171187560:1 gene:ENSMODG00000024455 transcript:ENSMODT00000035812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSLTLLFCTGGSCLQKVEQSPQALRVQEGEDTTINCSFTEFSQSLQWFRQDPGKGLISL
FYLTSEMKEKGRFRSTIILKERHSSLYIDASQPSDSATYLCAVR
Download sequence
Identical sequences F6Z7Z2
ENSMODP00000034226 ENSMODP00000034226 13616.ENSMODP00000034226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]