SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034228 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034228
Domain Number 1 Region: 24-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-24
Family V set domains (antibody variable domain-like) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034228   Gene: ENSMODG00000024456   Transcript: ENSMODT00000035814
Sequence length 134
Comment pep:novel chromosome:BROADO5:1:171080270:171081703:1 gene:ENSMODG00000024456 transcript:ENSMODT00000035814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRKIEKLLGVFLWIQLAWVSGQQLNQSPQSMNIQEGKSFTMNCTSSSSLYGLQWYKQK
PGERPSFILLLLSGGEKKSQEKFTAWFDEKKQLSSLSISAAQAEDSGTYLCAASTQHSLG
ICSLFTKPAPATPT
Download sequence
Identical sequences F6Z7X7
ENSMODP00000034228 ENSMODP00000034228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]