SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034238 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034238
Domain Number 1 Region: 47-318
Classification Level Classification E-value
Superfamily L domain-like 6.46e-57
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 352-446
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-21
Family I set domains 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034238   Gene: ENSMODG00000024461   Transcript: ENSMODT00000035824
Sequence length 640
Comment pep:novel chromosome:BROADO5:5:276711135:276713057:-1 gene:ENSMODG00000024461 transcript:ENSMODT00000035824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLRDIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPANLKGRYIGELDQNYFTCYAPVIVEPP
TDLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTLQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTENNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINNGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPIESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Download sequence
Identical sequences F6YIQ8
13616.ENSMODP00000034238 ENSMODP00000034238 XP_001362539.3.35504 XP_016278968.1.35504 XP_016278969.1.35504 XP_016278970.1.35504 ENSMODP00000034238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]