SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034356
Domain Number 1 Region: 665-740
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-19
Family SH3-domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 1761-1833
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-18
Family SH3-domain 0.00031
Further Details:      
 
Domain Number 3 Region: 1635-1712
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-17
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 801-848,936-1030
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000804
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 891-955
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000464
Family Fibronectin type III 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034356
Domain Number - Region: 420-531
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.067
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034356   Gene: ENSMODG00000014734   Transcript: ENSMODT00000035943
Sequence length 1868
Comment pep:novel chromosome:BROADO5:2:174137594:174183040:1 gene:ENSMODG00000014734 transcript:ENSMODT00000035943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVLGPGVLQCHRGSEPPSPAREKGEQGAMEPQALPTWPGWGPSPGGVPGSTAPMWGDA
LVALEAEEMDPEDTGSPGQMEDTPSGGEGAVSPRANSLSSATQLPESPGSIRRRLQCWGT
ENPSQTWLDSGGGVRPNMELLRALGEMQRQCAILKEENQQLRKSSFPETEEKVRRLKRKN
AELAVIAKRLEERAHKLQEANLLMVNAPMPRPGASLELARKVLASQRARDLSETASALLA
KDKQIAHLQRECQELQARLSSEGKEGPQWLNVWDFDRLLRESQQEVLRLQRQIALRNLQE
VPPTGSPSPLDTRVLPPAPGAPGEAVPLARSQDDVDLLPEGALLAEPESQQRVKQLELEL
GKKRKKWETLEHEVRKKQRRCEELELQLRKAQSENARLLEENSRLSGRASGKEEVESENV
ELRGRLQGVTEERDSALRKSQGLQSKLESLEQVLKHMREVAQRRQQLELEHEQARIGLQE
KQEEVLRLQQAQAQAKREHEGAVQLLETTLDSMQARVRELEEQCRSQTERFSLLAQELQA
FRTHPGPLDLLSSTLGTSSTELPPVPCCCSTPQPCRGPSPKDADLPPGSPRHGALRTPEA
VSIAHSGAPRRASRKAESLSNSSRSESIHNSPKSCPTPEVDTASEVEELEADSVSLLPEP
EGVFRGAKLQVFLARYSYNPFEGPNENPEAELPLTAGEYIYIYGNMDEDGFFEGELMDGR
RGLVPSNFVERVSDDDLMTSLPPELMDLSHSSGPELSFLSAGGAGSSGGQSSRGGSQARQ
EEERNELSPSPLLDPPAVPYPRHLAVLKQLAHSVVLTWEPPLDGAEVQGYHVCVDGKLHQ
ALGPGPPRKAVLEHPDLQSGSCCVSVQALTSQGSSDPLRCCLMVGAGAGVAPSQLRVHRL
TATSAEITWVPSNSNFAHAVYLNGEECPPARPGTYWGTFCHLRPGTPYQARVEARPITLR
PLEPSLEKLQNRAAVVHFTTLAAGPPDAPLDVQIEQGPSSGILLISWLPVTIDAAGSSNG
VRVTGYAIYADGQKIMEVASPTAGSVLVDLSQLQLLRECREVVVRTMSPHGESVDSIPAH
LPPALALAYPPAPVLRPSAASLLPSTSPEAKSLPCPASLSPRDSSPPPQPHHPPGSRDIE
GGLPSSPSKTAERLPQEDSTRNSQQEEPGVPTAAVWAPGGKRGQDTGPPLSGKEEEEEEA
VMAEKGQGESALTPSPAPGAPAEKMSGIEPGRGEISPGLRTRAEQREDTSDLGVRLTNSL
VDHGRSSDLSDIQEEEEEEEEEPGAESFSLTQHGETNDRENGAKLDSCETDSDEEILEQI
LELPLQQFCSKKLFSIPEEEEDEMEEEKKEEEKKGAEDSLACVHLPESQGMGLHRSGSRL
WELRSPPSAPDSSLGRDPPEELTPCQAGGSPLGSRRRGGGSPEKLPARKRPPDPREHCSR
LLGSSGTQASGRSGPSWDRGAPSSIEGVKCGTENSWKGWPGLSRRCSRGLAPESGLASCF
APKCLEISIEYDSEDEQESVGRGSSISSSSVCPRDGEGRGSGPEGAPLGGRRGAPGASTA
PSHCLRLSNCEKGELERRGRSLNCRVKEPSPRTPEARELRGQDAAGQRGPSRKGSRPPRL
SAPELAFSRNQTKEISPPNEPVRIFVALFDYDPVSMSPNPDAVEEELPFREGQLLKVCGE
KDADGFYRGECGGRVGYVPCNMVAEVAVGSPVVKRQLLQRGYLHPDSPKEGLGNGSFPLL
APHPAGPPPKPRRSKKGSSSQPDVRASPSTPHSMVAAFDYNPRENSPNVDVEAELSFKAG
DVITVFGAMDDDGFYYGELNGQRGLVPSNFLEGVISGEDRKVVGPSKEKDPGVLMAESQR
MRKRRVQC
Download sequence
Identical sequences F7E3H7
ENSMODP00000034356 ENSMODP00000034356 XP_007481883.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]