SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034639 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034639
Domain Number 1 Region: 191-281
Classification Level Classification E-value
Superfamily Immunoglobulin 9.79e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 93-195
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-16
Family C1 set domains (antibody constant domain-like) 0.043
Further Details:      
 
Domain Number 3 Region: 2-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000339
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034639   Gene: ENSMODG00000010160   Transcript: ENSMODT00000036227
Sequence length 360
Comment pep:novel chromosome:BROADO5:2:166989547:167002547:-1 gene:ENSMODG00000010160 transcript:ENSMODT00000036227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVVAGDTVQLKCQVKDPDSSSLQWSNPAQQTLYFGEKRALRDNRIQLVRSTPNELTISI
SKVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPQITGYVSAIPEKGKAHLTCLSKGS
KPAAEISWRKGDQELKGKPLMVQEDVNKTFTVSSSVEFQVFREDDGVDVTCSVKHKSLQD
MDRSTSQRIEVLYTPTAMIRPYPQHPREGEKLMLQCEGHGNPVPQQYEWVKTGIEPPLLM
THESALIFPFLNKSDSGTYRCTASNNMGSHIAYYTLDVSDHSPVISTSSTYHAVIGGIVA
FIVFLLLILLIILGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI
Download sequence
Identical sequences F7BU41
ENSMODP00000034639 ENSMODP00000034639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]