SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034660 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034660
Domain Number 1 Region: 29-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000369
Family I set domains 0.0015
Further Details:      
 
Domain Number 2 Region: 204-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000136
Family I set domains 0.00024
Further Details:      
 
Domain Number 3 Region: 121-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000476
Family I set domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034660   Gene: ENSMODG00000010143   Transcript: ENSMODT00000036249
Sequence length 363
Comment pep:novel chromosome:BROADO5:2:166715007:166839063:-1 gene:ENSMODG00000010143 transcript:ENSMODT00000036249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSAFTPKLLLVMLLFWASSGKSIDATSRAVVSLKPSWRIPEGKKVTLHCEGPSISSSN
QTQWLHNHTSIQAKTPIFIIHSATIKDSGEYRCKIGNSSFSDPTYLGVHSASYKSSKDAV
SKSILSLNPSWRIFIGENVTLHCEGFTTSGSNQTQWLHNGSSISVQTPTYDITFATMNMS
GEYMCQNGDSAFSDPVYLGIYSDWLLLQPSLAIIKEGEPLVLSCHGWKNRTVYKVTYYHN
NKALKYWYENHKYYISYATVQNRGYYYCTGILWRIPYTSKPLYIDFKDQELSVSNFLPGT
LSYLQFLFPLVTGILFTVDTTLLVLTKKQLHNLSEKKKVSLNSKTHSLTSFSDPPPLPPP
PAQ
Download sequence
Identical sequences F7B736
ENSMODP00000034660 ENSMODP00000034660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]