SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034678 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034678
Domain Number 1 Region: 77-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000799
Family I set domains 0.0045
Further Details:      
 
Domain Number 2 Region: 165-256
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000661
Family I set domains 0.065
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000783
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034678   Gene: ENSMODG00000024578   Transcript: ENSMODT00000036267
Sequence length 258
Comment pep:novel chromosome:BROADO5:2:166215718:166222196:-1 gene:ENSMODG00000024578 transcript:ENSMODT00000036267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKPILSLQPPWTTVFSKEKVKLTCEQLNLTGLSDILWYRNGEKFYQSSRNSIVIWKSGQY
SCGSQGYAPSDPVAITFSNDWLILQVPYSVFEGDAVILQCQGWKKAKLSQVTFHKERKFI
HFTKENNSLPIKSARIEHSGLYSCSGYVNHQKNNQSSTPAILQLFPPPELRIKNSTETME
GNLMALSCETQLPLQRSSSQLYFSFFKDNKTIRDRDQSPEYCIPGTIIGDAGLYWCEAAT
EDGQVKKQSLGLEIQVSG
Download sequence
Identical sequences F7B6L3
ENSMODP00000034678 13616.ENSMODP00000034678 ENSMODP00000034678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]