SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034921 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034921
Domain Number 1 Region: 28-520
Classification Level Classification E-value
Superfamily Sema domain 4.58e-193
Family Sema domain 0.00000000000000525
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000855
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 586-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000284
Family V set domains (antibody variable domain-like) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034921   Gene: ENSMODG00000016983   Transcript: ENSMODT00000036509
Sequence length 772
Comment pep:novel chromosome:BROADO5:8:143957569:144263826:1 gene:ENSMODG00000016983 transcript:ENSMODT00000036509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLQRIAYLFWGVLLAARANYQNMKNNVPRLKLSYKEMLESNNVITFSGLTNSSSYHTF
LLDEERSRLYVGAKDHIFSFSLVNIKDFQKIAWPVSHTRRDECKWAGKDILKECANFIKV
LKAYNQTHLYACGTGAFHPICTYIEIGRHPEDNIFKLEDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISVHLIPESDNPED
DKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMTDVRRVFLGPYAHRD
GPNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRP
IMIKTDVKYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTTITAMKISTKQQQLYIGSSTGIAQLPLHRCDIYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNYHGHGFEEKIIYGVENSSTFLECSP
KSQRALIYWQFQRQNEERKEEIRVDDRIIKTEQGLLLRSLQRKDSGIYLCHAVEHGFMQT
LLKVTLEVIDTDHLEELLHKDDDGDSAKTKDISNGMTPNQKVWYRDFMQLINHPNLNTMD
EFCEQVWKRDRKQRRQRPGNSQVNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences F6Q9V8
ENSMODP00000034921 XP_001369710.2.35504 XP_007504071.1.35504 XP_007504073.1.35504 XP_016281538.1.35504 ENSMODP00000034921 13616.ENSMODP00000034921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]