SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035165 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035165
Domain Number 1 Region: 514-835
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-82
Family Protein kinases, catalytic subunit 0.000000282
Further Details:      
 
Domain Number 2 Region: 78-191
Classification Level Classification E-value
Superfamily L domain-like 3.74e-19
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 209-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000175
Family I set domains 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035165   Gene: ENSMODG00000019593   Transcript: ENSMODT00000036755
Sequence length 850
Comment pep:novel chromosome:BROADO5:1:123899457:124344493:1 gene:ENSMODG00000019593 transcript:ENSMODT00000036755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSLCPTKCSFWRIFLLGSFWLDYLGSVLACPANCVCSKTEINCKNPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRNIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLFCISTDGSRIPLQRMNITQCDLPEISVSHINLTVREGENAVITCNGSGSPLPD
VDWTVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVMSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIRVEYYQEGEVSE
GCLLFNKPTHYNNGNYTLIAKNQLGTANQTIKGHFLKEPFPESTDNFVSIYEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYREGPSRKGQF
STTWQRQRLAAPAATTVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQ
PWFQLSNTEVIECITQGRVLERPRVCPKEVYDIMLGCWQREPQQRLNIKEIYKILHALGK
ATPIYLDILG
Download sequence
Identical sequences F7FCZ2
XP_007479445.1.35504 ENSMODP00000035165 ENSMODP00000035165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]