SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035184 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035184
Domain Number 1 Region: 1853-1984
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-44
Family C-type lectin domain 0.000000327
Further Details:      
 
Domain Number 2 Region: 152-260
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-42
Family Link domain 0.0017
Further Details:      
 
Domain Number 3 Region: 501-609
Classification Level Classification E-value
Superfamily C-type lectin-like 2.98e-41
Family Link domain 0.0011
Further Details:      
 
Domain Number 4 Region: 614-706
Classification Level Classification E-value
Superfamily C-type lectin-like 3.09e-29
Family Link domain 0.0061
Further Details:      
 
Domain Number 5 Region: 261-356
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-28
Family Link domain 0.0029
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000413
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 7 Region: 1985-2045
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035184   Gene: ENSMODG00000019581   Transcript: ENSMODT00000036773
Sequence length 2070
Comment pep:novel chromosome:BROADO5:1:123202296:123296907:-1 gene:ENSMODG00000019581 transcript:ENSMODT00000036773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLLVLMSLRVIAAAISVEVSDHANLLSVSIPEPSPLRVLLGNSLTIPCYFIDPIHPV
TTAPSTPPLSPRIKWSRLSEEKEVVLLVATEGRVRINSAYQDKISLPNYPAIPSDATLEI
NNLRSNDSGIYRCEVMHGIEDSHATLEVIVKGIVFHYRAISTRYTLDFEKAQQACLQNSA
VIATPEQLQAAYDDGYHQCDAGWLADQTVRYPIHSPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYSTSPEKFTFQEAANECRRLGARLATTGQLYLAWQSGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPLSRYDAICYTGEDFVDIIPE
SFTDDLSSEGEITIQTVTQPDVELQLPQNATKQESRGSVITSEDVITPTGLEPEEAFTWT
LGGTGYPEIENETDEAIKQWHFPEVTDSSHDGLFPIGVTQRAATSTPELEPATPFTGEDL
IVQVTAAPGVAAVPEQPFSPTGVVFHYRPGSTRYSLTYEEAQQACRSTGAVIATPEQLQE
AYEAGYEQCDAGWLRDQTVRYPIVSPRTQCVGNKDSSPGVRSYGLRPASETYDVYCYVDW
LLGEVFFATRLELFTFQEALAYCEDHNATLASTGQLYAAWRRGLDKCHAGWLADGSVRYP
IITPRSACGGDKPGVRTVYLYSNQTGFPDPLSRHHAFCFQAGPSLEEDKGVTQTSIIDEE
LIPTQVAPKEGGALSREEFDFTTVPENQTEWETNFFPTNTSLLSVSPSSWPPTSAIPEES
ILSASIEPYESSKGPSSGSGEPSSSGEPSGVPDISGSGEPSTFGEPSGVPDMSGSGEPST
SGEPSGILDMSGSGEPSASGEPSGIPDMSGSGEPSTFGEPSGVPDISGTGEPSASGEPSG
VPDVGVPYVSGSGEPSASGEPSGVPDVGVPHMSGSGEPSASGEQSGVPDVDILDVSASGE
PLTSGEPVTVPGFGIPDVSGSGEPSASGEPSNVPDVSGDVIGSGEASGGFETSGQPSGGL
DFSGLSSGVASGLPGETGLSSGEADVSGWSSTTEVSGLPSGDDLIGSASEHFDLGELPSG
SLGSGQTPETSGLPSGFSGEHSGVDFGSGLSSGLPDLSGFPSGFPTVSLVDTTLVEVVTA
TTASQLEGKGTIGISGQGEISGLPSGEWDISGVTSGLPSGTELSGQASGLPDSSGETSGI
FGISGQTSGIPEASGETSGLFDVSGYASGTPEARGETSGIFGISGQASGFPDASGETSEI
FYSTQKPSEVPYFSGQPSGLPDASGETSGVLETSGELSGVLDISGETSGVRFHSGQPFEV
TDLSGATSGVFDISGQPSGVPGFSGETSGISDLSGVGDLSGLVSGTVSGSGESPNVTFVD
TSFIEVAPTAFREKEEGLGSTEVSGFPSGEIDISGSFSGIVDISGQSSGTIESSGLASGT
PEFSGLPSGSVELSGESSGTGIGSGLPSGEYDSSSSGLSSGFPTISLVDKTLVESATPIP
IAQEAGEGPSGVLEISGTHSGETEISGEISGTLDLSGSQSGLIETSGESFSTPSFSGDFS
GITDISGELSAVTSSSGEASGFPEVTLITTDLKEAVPKPTVSQELSQGSLVTLSHFVESS
GESPVSGDFSGMSTIHETEVEASTVPEVSGELSAYPETSAVPDVSGTTSALYETDHEEAS
SLNGSGEPSVFQEVTSKSSSTTDVSGDSSAFHEISEETSATHDVSGETSTPSNVDLETSS
VPLTSGEFPVSFEDRTEVSGETSGTQTFSVPTVSGDTSLPDVVISTSVPETEFRHQTQSP
EEAQTEIESSSPLISGEETERADVSETGTDSSPTDTSIASQVSPEEKEESESTTEDQEIC
EEGWTKFQGHCYRHFPDRETWVDAESQCREHQSHLSSIVTPEEQEFVNNNAQDYQWIGLN
DRTIEGDFRWSDGHPLQFENWRPNQPDNFFATGEDCVVMIWHEKGEWNDVPCNYHLPFTC
KKGTVACGDPPTVEHARTFGQKKDRYEINSLVRYQCSEGFVQRHVPTIRCLPSGQWEEPQ
IACIDPTTYKRRLQKRNSQPQRKNVHSTAH
Download sequence
Identical sequences F7EZE4
ENSMODP00000035184 ENSMODP00000035184 XP_016283817.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]