SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035233 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035233
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-43
Family Phosphotyrosine-binding domain (PTB) 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035233
Domain Number - Region: 138-172
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00772
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035233   Gene: ENSMODG00000010712   Transcript: ENSMODT00000036821
Sequence length 267
Comment pep:novel chromosome:BROADO5:4:205010665:205093752:1 gene:ENSMODG00000010712 transcript:ENSMODT00000036821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDNFQFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKTPKVELQISIYGVKILEP
KTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQA
FDLAYRKFLESGGKDVETRKQIAGLQKRIQELETENIELRNKVQDLENQLRITQISTSPA
SSVTPKSPSTDIFDMVPFSPITPQLSTPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNC
GAGDFPPDIQSKLDEMQRQRWRGSKWD
Download sequence
Identical sequences F7AFH4
ENSMODP00000035233 ENSMODP00000035233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]