SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035638 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035638
Domain Number 1 Region: 92-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000293
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035638   Gene: ENSMODG00000024792   Transcript: ENSMODT00000037225
Sequence length 256
Comment pep:novel chromosome:BROADO5:2:110886380:110887147:-1 gene:ENSMODG00000024792 transcript:ENSMODT00000037225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTIDVGIILGTLAFAFYLPVTMTTSHQTLKIPEKLKLAHGRVIVNATPCTVTCGLGYKE
EETCEVGPDGVKRECETHQTECQTNWICGMVHFTVPVGKKFELTCLSSDILHYGHEAFRF
TWKFAYGIVSTDDELFKPFQRHIHSVIFTPAQELDSGTYRCDVQLLRNLKFVKRIYFALR
VIPSNLVNLNFDQSLSEEQKLMDEGMELDQGNQTHFQHVKQTKKAWVVLGVGITVGVLGG
MLFSTVLYSLMKISNR
Download sequence
Identical sequences F7G064
ENSMODP00000035638 ENSMODP00000035638 13616.ENSMODP00000035638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]