SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035673 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035673
Domain Number 1 Region: 28-382
Classification Level Classification E-value
Superfamily L domain-like 1.36e-63
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 425-514
Classification Level Classification E-value
Superfamily Immunoglobulin 4.52e-18
Family I set domains 0.038
Further Details:      
 
Domain Number 3 Region: 529-614
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000258
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035673   Gene: ENSMODG00000024800   Transcript: ENSMODT00000037259
Sequence length 713
Comment pep:novel chromosome:BROADO5:2:110146354:110148495:-1 gene:ENSMODG00000024800 transcript:ENSMODT00000037259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLLVHLVLAWIAEAAAPVPVVPWRVPCPPQCTCQIRPWYTPRSVYREATTVDCNDLFL
SSVPPGLPSGTQTLLLQSNNIARVEQNELDYLANLTELDLSQNGFSDARDFGLRALPQLL
SLHLEENQLTQLEDDSFAGLANLQELYLNHNQLRRISPGAFTGLGNLLRLHLNSNLLQAV
DSRWFQVLPSLEVLMIGGNKVDAILDMNFRPLANLRSLVLAGMNLQEISDYALEGLRSLE
SLSFYDNKLARVPKRALEHVPGLKFLDLNKNPLQRVGPGDFTNMLHLKELGLNNMEELVS
IDKFALVNLPELTKLDITNNPRLSFVHPRAFRHLPQMETLMLNNNALSALHQQTVESLPN
LQEIGLHGNPIRCDCVIRWANTTGTHVRFIEPQSTLCAEPPDLQHCPVRDVPFREMTNHC
LPLISPRSFPPSLQVARGGNLALHCRALAEPEPEIYWVTPAGMRLTATQAGGRYRIYPEG
TLEIREVTEEEAGLYTCVAQNLVGADTKSVSLAIGGSLPGSSGLERELELRVQEVHPYHI
LLRWEPLPNTISTNLTWSSSSSLRGPGTTALARLPGGTHSYNITRLLQATEYWVCLQVAF
ADAHTQVACIWARTKEASPQHGALGGHLGLLAALGLSALLLAAGLAVHWGPYPTRPSGRV
GGKPLLPSWAPWGRSTPSVRVVSPPFVKHWNPGREPTKLAEGEMVLPVILHDS
Download sequence
Identical sequences F7FNX9
XP_001371227.1.35504 13616.ENSMODP00000035673 ENSMODP00000035673 ENSMODP00000035673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]