SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035702 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035702
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-57
Family Eukaryotic proteases 0.000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035702   Gene: ENSMODG00000024809   Transcript: ENSMODT00000037288
Sequence length 209
Comment pep:novel chromosome:BROADO5:8:108623562:108624191:-1 gene:ENSMODG00000024809 transcript:ENSMODT00000037288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTAAHTVYPKDSFSQENRSVNVFLGHTDVEEIIRLGPHPVHRVIVHPDYRPEEPNNFEG
DIALLELENSVPLSPNILPICLPDNETLYGNGLMGYVSGFGMENGRLASQLRYVHLPIAK
RDACEAWLQKKNRTEVFSPNMFCAGDRTLKQDACQGDSGGVFAVWDNATERWRATGIVSW
GIGCSKGYGFYTKVLNYMDWIKATIEGDS
Download sequence
Identical sequences F7C5M9
13616.ENSMODP00000035702 ENSMODP00000035702 ENSMODP00000035702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]