SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035757 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035757
Domain Number 1 Region: 24-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000882
Family V set domains (antibody variable domain-like) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035757   Gene: ENSMODG00000016234   Transcript: ENSMODT00000037341
Sequence length 222
Comment pep:novel chromosome:BROADO5:7:192401580:192443649:-1 gene:ENSMODG00000016234 transcript:ENSMODT00000037341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLRTRHHAKDYVTGSSTVHKILVKQPHLLVTYNHELVNVSCDYIYDKTPTEFRASLQKG
KNGAHEVCSVYVNGTHKPLITTTEDFRCHVNFDNKTVMFCLLNMSIFQTDIYFCKIEFMY
PPPYFSSEVNNGTFIYVKEKDVCTTLGSSEPPKPFWPVVAALCVFAFYSMLITVAFCNCW
LKSKKNRILHSDYMNMTPQRPGPTKKHYQPYAPSRDYAAYRS
Download sequence
Identical sequences F7FLK0
13616.ENSMODP00000020294 ENSMODP00000020294 ENSMODP00000035757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]