SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035778 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035778
Domain Number 1 Region: 121-230
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-32
Family V set domains (antibody variable domain-like) 0.00088
Further Details:      
 
Domain Number 2 Region: 231-303
Classification Level Classification E-value
Superfamily Immunoglobulin 5.18e-22
Family C2 set domains 0.0035
Further Details:      
 
Domain Number 3 Region: 17-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000042
Family C2 set domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035778
Domain Number - Region: 3-23
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00101
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035778   Gene: ENSMODG00000027359   Transcript: ENSMODT00000037363
Sequence length 369
Comment pep:known chromosome:BROADO5:8:108253911:108258922:1 gene:ENSMODG00000027359 transcript:ENSMODT00000037363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFPLTIQYLETSDSGMYFCEVEDKKQQVQLLVFKVTANPSESVLSGNNVTLTLHSPPN
LPELKIEWHGPGNTSKRILSSNKKTLNLLQVDSEEEGEWSCTVSINGKSLKLSKRVTVHG
FRHPYQRYYKIAGKDAEFNFPLNLGEQDLNRMVPNGELTWHGEGAASQRLAKFSWKDDSL
TLEDKFKFKLSKGRPITLSLSPVLLHHAGSGVFSLMLPSGTVKQKVDLVVMRAMSHDQQL
YCELSGPIIPGLTLRWQLENQTKETLEVSEKQRKLELKQPKAGMWECQLLLKDQKLLKSN
SFQLAARSEWYQPQYLAIGLGTGASLLLLFGFIMFCYARRRHRLRRAERMSQIRRLLSEK
KTCQCPHRF
Download sequence
Identical sequences F7AB77
XP_007503559.1.35504 XP_007503560.1.35504 XP_016280846.1.35504 ENSMODP00000035778 ENSMODP00000035778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]