SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035998 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035998
Domain Number 1 Region: 632-739
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 142-248
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 3 Region: 248-354
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 4 Region: 383-488
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 5 Region: 874-979
Classification Level Classification E-value
Superfamily SRCR-like 7.32e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 
Domain Number 6 Region: 488-594
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 7 Region: 36-138
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 8 Region: 999-1103
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 9 Region: 759-870
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-31
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035998   Gene: ENSMODG00000008170   Transcript: ENSMODT00000037587
Sequence length 1388
Comment pep:novel chromosome:BROADO5:1:85178217:85270431:-1 gene:ENSMODG00000008170 transcript:ENSMODT00000037587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMFLGLWLLCCQLLFAAVTTDSRTNTVDFTTGLPLLLVNGKNRCEGRVEILYQGYWG
TVCDDDWDTKDADVVCRQLNCGHAVSALGGAYFDQGSGNILLDDVNCSGTESYLSNCPHR
GFYNHNCGHGEDAGVICSLSDSSLSLSLVNGMDRCQGRVEVLYQGSWGTVCDDDWDLNDA
NVVCRQLGCGYAVSAPGNARFGQGSGRIVMDNVRCSGYESYLWNCPHNGWLSHNCQHSED
ASVICSDSSLSLSLVNGMDRCQGRVEVLYQGSWGTVCDDDWDLNDANVVCRQLGCGYAVS
APGNARFGQGSGRIVMDNVRCSGYESYLWNCPHNGWLSHNCQHSEDASVICSGIVPGKHV
QIGLSLSSHVSEESWLLCDYSNLSLTLVNGMDRCQGRVEVLYQGSWGTVCDDDWDLNDAN
VVCRQLGCGYAVSAPGNARFGQGSGRIVMDNVRCSGYESYLWNCPHNGWLSHNCQHSEDA
SVICSDSNLSLTLVNGMDRCQGRVEVLYQGSWGTVCDDDWDLNDANVVCRQLGCGYAVSA
PGNARFGQGNGSIVLDDVRCSGYESYLWYCPHRGWLSHNCQHSEDASVICSASTTNLPTN
IPSRPNYPTPVGTTFPRTDFTTETTTSGPNSNLSLTLVNGMDRCQGRVEVLYQGSWGTVC
DDDWDLNDANVVCRQLGCGYAVSAPGNARFGQGNGSIVLDDVRCSGYESYLWNCPHRGWL
SHNCQHSEDASVICSESTTAIPTTPDWWNPTTTYARPPSCGGVIFSDSGSFSTPSYPSFY
PNNITCVWEIVVNYTFRINLGFNNLQLEPHNSCIHDYVEIFDGGLNSWLLGKLCNQTQQI
FTSSSNRLTVRFVSDISVQNIGFSVWFNSFPRDAALRLTNSTRDCAGRVEVYHNGQWGTV
CDDNWGLQDAQVVCRQLGCGIATLAPGNAYFGAGSGLITLDDVQCRGSEWNLWQCKNNGW
FSHNCGHNEDAGVICSGPSTTPDYFTSPPVTSHSCGEFFSQASGSFSSPNYPGYYPNNAK
CVWDIEVSNNNVVTIVFEDVQLEGGCNYDYIQVYDGPYQTSPLITRVCDRGRGSFTSTSN
YMSIRFITDGSVTRKGFWARFYSTPSNDSTSLVCLPEEMRATISKSYLQSMGYNSLNFGV
YNSSCWPMENSSYFIFVIPYNGCGTIKSINNDTINYSNFLISNQATGQNRVITRHKNLHF
RISCKMLRNIWVESMFITNETAEIKEIQYGNFHVDMSYYASSSFFPPVNSTPYIVQLNQN
LYLQAEIQHYDSNLVLFVDTCTASPNANDFKTLTYDLIRNGCHKDNTYITYYSPLPRQVR
FGFKSFAFLEKFPSVYLQCKLVVCQAYDYSSRCYRGCITRSKRDTSSYQEKVDVVMGPFQ
LQKKEAKN
Download sequence
Identical sequences F6YU61
ENSMODP00000035998 ENSMODP00000035998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]