SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036018 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036018
Domain Number 1 Region: 245-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000136
Family I set domains 0.042
Further Details:      
 
Domain Number 2 Region: 63-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000237
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 161-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000296
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 1-73
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000248
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036018   Gene: ENSMODG00000028445   Transcript: ENSMODT00000037607
Sequence length 355
Comment pep:novel chromosome:BROADO5:Un:33890494:33933620:-1 gene:ENSMODG00000028445 transcript:ENSMODT00000037607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCQATGQIHAYRWFINGVAPAGSRIQLSPDKKILTIPNLTRRDNKGPYVCEIENPLFSN
RSDPFTLDVAYGPDIAMIVRTQDVYPTGANITLSCSAISNPPVQFTWLQNGQPVSNSATF
SFIASLNRAGTYTCIASNSFTGLARTANKTLIIYAPLSKPTILTSNRTAVETKDFSLTCQ
GTGQIHAYRWFINGLAPSGSRIQLSPDKKILTIGNLTRRENKGPYVCEIENPLFRNRSDP
FTLNVTYGPDFATIAHSVDEYPIGANITLSCSAVSNPPVQFTWLHNGQPVSNSATFSFIA
SMTLSGTYTCNAANSLTGLTRSATKNVIIYDKDPANCSQASQREAGPLRKSKTGS
Download sequence
Identical sequences H9H8S8
ENSMODP00000036018 ENSMODP00000040228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]