SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036810 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036810
Domain Number 1 Region: 2677-2957
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-71
Family Protein kinases, catalytic subunit 0.00000142
Further Details:      
 
Domain Number 2 Region: 1274-1453
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-52
Family DBL homology domain (DH-domain) 0.0000000132
Further Details:      
 
Domain Number 3 Region: 1913-2106
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-50
Family DBL homology domain (DH-domain) 0.0000212
Further Details:      
 
Domain Number 4 Region: 1460-1580
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2107-2224
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-32
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 6 Region: 2545-2657
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-25
Family Fibronectin type III 0.00083
Further Details:      
 
Domain Number 7 Region: 2464-2568
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-24
Family I set domains 0.007
Further Details:      
 
Domain Number 8 Region: 272-408
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1092-1229
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 10 Region: 494-635
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 836-995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000408
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 2314-2377
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000013
Family SH3-domain 0.0000323
Further Details:      
 
Domain Number 13 Region: 29-176
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000288
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 14 Region: 185-303
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 640-760
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000131
Family Spectrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036810   Gene: ENSMODG00000018350   Transcript: ENSMODT00000038406
Sequence length 2979
Comment pep:novel chromosome:BROADO5:4:89593101:90538674:1 gene:ENSMODG00000018350 transcript:ENSMODT00000038406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEWWTWSLEVLRLLVRSSFRNDGLKAADVLPILKEKVAFVSGGRDKRGGPILTFPARSNH
DRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVA
LIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLAKLVDPSQLTEEFEGSLDYNHDEWIEL
RVSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELD
REGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKL
DQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYV
NINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQ
FLSGVEAWCKMCSEGGLPSETQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPL
SPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQ
QVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQ
TGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKELLE
DVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAFQSRFSLLCYRDSAV
SSNKMPHNSSISHIESVLQQLDEAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELD
AWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASG
IELICEKDIDLAAQVQELLEFLHEKQHELELNADQTHKRLEQCLQLRHLQAEVKQVLGWI
RNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEVL
LQAGHYDADAIRECAEKVAMHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEY
RRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVS
MPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWI
QETGEYFLSTHSATGESTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHA
TEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRD
ASHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKE
HIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSSQLI
LEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVM
LSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLV
FSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASSIE
TKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVDDIDSQGDGSSQPD
TISIASRTSQNTVDSDKVGRFLSSHPHSQTSFYHTSELTGSGKGQEDLSERKSQPRGPDL
STEDPGEEGIIPDTGKSLGRSRERPLFASFVPLRLPADAYSGSSGENGGKSESVANLQPQ
SSLNSIQSSPGPKRSTNTLKKWLTSPVRRLNSGKAESNIKKQKKVRDGRKSFDLGSPKTG
DETTPQGDSADEKSKKSWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAARQGSAD
VPTAADLVSAIEKLVKSKLSLEGGSYRGSLKDPTGCLNEGMTPPTPPRNLEEEQKAKALR
GRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQIYDWHKD
FFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDSYFEEVKQEISQ
RLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECADIEKAVELMCLVPKRCNDMMNLG
RLQGFEGTLTAQGKLLQQDTFYVIEQDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPG
YMFKRSIKMNYLVLEENVDNDPCKFALMSRETSERVVLQAANADIQQAWVQDINQVLDTQ
RDFLNALQSPIEYQRKERSTAVMRTQPPRVPQASPRPYSAVPVGAEKPPKGSSWNPSLPP
LKISTSNGSPGFDYHQPGDKYEPSKQSDMGGCNGTSSMAVIKDYYALKENEICVSQGEVV
QVLAINQQNMCLVYQPASDHSPAAEGWVPGTILAPLTKATAAAENSDGSIKKSCSWHTLR
MRKRAEMENTGKNEATGPRKSKEILGSKVSVKEMNSSEESECDDLDPNTSMEILNPNFIQ
EVAPEFLVPLMDVTCLLGDTVTLQCKVCGRPKPSIIWKGPDQNILDNDNSTATYTVSSCD
SGEITLKICNLMPQDSGIYTCVATNDHGTASTSATIKVQGVPAAPNRPIAQERSCTSVIL
RWLPPSSTGNCTISGYTVEYREEGSQVWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNP
WGISLPSEPSEFVRLPEYDAAADGATISWKDNFDLAYTELNEIGRGRFSIVKKCIHKATR
KDVAVKFISKKMKKKEQAAHEAALLQHLQHPQYVTLHDTYESPTSYILVLELMDDGRLLD
YLMNHDELMEEKVAFYIRDTMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDLED
AVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEE
TCINVCRVDFSFPHEYFCGVSNTARDFINVMLQEDFRRRPTAATCLQHPWLQPHNGSYSK
IPLDTSRLACFIERRKHQNDIRPVPNVKSFIVSRMNQGT
Download sequence
Identical sequences F6VPX9
ENSMODP00000036810 13616.ENSMODP00000036810 ENSMODP00000036810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]