SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036920 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036920
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000393
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 
Domain Number 2 Region: 88-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000645
Family C2 set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036920   Gene: ENSMODG00000025108   Transcript: ENSMODT00000038516
Sequence length 295
Comment pep:novel chromosome:BROADO5:4:86370463:86396319:1 gene:ENSMODG00000025108 transcript:ENSMODT00000038516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAVAAATKPKVEALFNGTVDLSCNFKNPEGISLEELLIFWQDANDLVLYELYQGREKQ
DHIHEKYLNRTEYNQTTWTLQLRNIQIEDQREYKCLVQHRSPRGLVLVHRFSFQLFVFAP
FSQPEITRLDNMTVKIGDVLNFSCSSEQGYPEPEEMYWMITTENSTKIPGIMDLSQDKTT
QLYNVRSTLTLTFNETTRTNISCYLQTVRQKEPLISKILTIEIQSNEDLGNNHLEVILGV
LAVLAVPIVIVIFCWIKRRYLCCQRGTTKEKGEDPGHLEEKQALPTTGHTEQEEK
Download sequence
Identical sequences F6RP67
ENSMODP00000036920 ENSMODP00000036920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]