SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036962 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000036962
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00727
Family Fibronectin type III 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036962   Gene: ENSMODG00000028677   Transcript: ENSMODT00000038558
Sequence length 222
Comment pep:novel chromosome:BROADO5:2:38206620:38216494:-1 gene:ENSMODG00000028677 transcript:ENSMODT00000038558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPPKPEISEDENQANMQSFSRTSSGGSFIVSNIPTTVPDVFPPNRIIDLEANVEDDHIN
LTWTAPGDDFDTGRAEEYIIKMSKDILTLRENFDAALQVNTTDLIPNDANSKEDFMFKPD
FLIENGTTVFLAIKAVDKANLTSPISNIAQASLIIPSAEDPFSPSAEDPFSPSAEDPFSP
SPEDPFSPSGTSISTIVLSVVGTVAAVAIIVSVTVCVMKKKR
Download sequence
Identical sequences F6R2Z9
ENSMODP00000036962 ENSMODP00000036962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]