SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037028
Domain Number 1 Region: 108-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 58-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037028
Domain Number - Region: 542-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00484
Family TSP-1 type 1 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037028   Gene: ENSMODG00000003403   Transcript: ENSMODT00000038626
Sequence length 585
Comment pep:novel chromosome:BROADO5:2:35256677:35316034:1 gene:ENSMODG00000003403 transcript:ENSMODT00000038626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWHQWPLKLLLLCTVLACLHLYNSKCERKLFEDLIIKRNFTNGRRVHNQLGTPKPIDC
LVSSWSQWSLCDPCEKKRYRFVKVLRPSQFNGKACGLIDDSEPCSNMTSCIIPEVPCQGF
NCNLTGRCIPLSQVCNGDNDCGDGADENDCKEVTKLCQGSKNQYWGTGSLASGINIFTNA
LEGVVFDNNYYGGNCNAFVIDQDKYRLPSNLERYSIEVRGYYEFVYKEYESYAAFERSVI
REGMKDKKMGPDLHILNWIDIGYNFESQSLRRFLSKIRRATQSKSKILHVQCTIDIGRYK
MKSKLLMFDYEFLMRVGRLPSDYSYGEYRDFIRAYGTHIISDAIIGGVYEYALILNPDGM
DSEGYTFDDIKSCTQEAYHSSDITNRDFVGMRMDQRCHVLLDQIANLGKTEEDVPIVEDL
AVFLRGGTIPSITSLAYKRLPNKELMEKWGDAAKLFPEVLKIKVIPMHEMWTGQNFINRL
HLKNNMRSAVKEYYEETHVCHCAPCLGNGFPIIRDSYCECLCGMGTCGISCELGTSEGDA
TGSWSCWTSWTECIEAKQKRERLCNSPIPGSIKTCPGRQKEETSC
Download sequence
Identical sequences F6YTA8
XP_007480577.1.35504 XP_007480578.1.35504 XP_007480579.1.35504 XP_007480580.1.35504 XP_007480581.1.35504 XP_007480582.1.35504 XP_007480583.1.35504 ENSMODP00000037028 ENSMODP00000037028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]