SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037047 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037047
Domain Number 1 Region: 5-185
Classification Level Classification E-value
Superfamily PR-1-like 2.22e-44
Family PR-1-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037047   Gene: ENSMODG00000025130   Transcript: ENSMODT00000038645
Sequence length 295
Comment pep:novel chromosome:BROADO5:8:44202819:44231321:1 gene:ENSMODG00000025130 transcript:ENSMODT00000038645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIWLRIFCLLFFSCQRSKSLSYAPIYKDQEFIFECVDVHNLLRTQLHPPAANLQYITWD
EGLAKTAKAWAKRCHPGHNTHLENIRQSHPIFNGLGENIWTGPIYLYSPRLAVKSWFSEE
QFYDFQTNTCSRVCSSYIQVVWDTTYKIGCAAATCPRVGNLTDVIHFICNYVLSGNTNRR
PYKEGKFCTQCSKGDKCLDMLCSNSEREKLKHYPFWYPEWEVPRPVVCDLRCLSCLTFRI
ILFMLAVLIVFLLQHKFPNIQLEKDILLITTEKETVSKEYYPGSNQTPQQEENRV
Download sequence
Identical sequences F6YS34
ENSMODP00000037047 ENSMODP00000037047 XP_007503128.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]