SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037178 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037178
Domain Number 1 Region: 15-396
Classification Level Classification E-value
Superfamily L domain-like 4.65e-60
Family Ngr ectodomain-like 0.072
Further Details:      
 
Domain Number 2 Region: 418-509
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-20
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037178   Gene: ENSMODG00000025148   Transcript: ENSMODT00000038777
Sequence length 615
Comment pep:novel chromosome:BROADO5:6:45005249:45007096:-1 gene:ENSMODG00000025148 transcript:ENSMODT00000038777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGVDHRGGVMLHTAISCWQPFLGLAVVLIFMGSTIGCPARCDCLPHNKSVSCHRKRLIAI
PEGIPIETKILDLSKNRLKSVNPEEFMSYPLLEEIDLSDNIIANVEPGAFNNLFNLRSLR
LKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHR
AFSGLLSLEQLTLEKCNLTAVPTEALSHLRNLISLHLRYLNINVMPVYAFKRLFHLKHLE
IDYWPLLDLMPANSLYGLNLTSLSITNTNLSTVPYPAFKHLVYLTHLNLSYNPISTIEAG
MFADLIRLQELHVVGAQLRTIEPHAFQGLRFLRVLNVSQNLLETLEENVFYSPRALEVLS
ISSNPLACDCRLLWILQRQPLLQFGGQQPMCAGPDSIREKPFKDFHSTALSFYFTCKKPK
IRDKKMQYLLVDEGQTVQLVCNADGDPQPVISWATPRRRLITTKSNGRVTVLGDGTLEIR
FAQDQDTGVYVCIASNAAGNDTYTASLTVKGFASDRFLYANRTPMYMTDSNDTSSNGTNA
NTFSLDLKTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVV
EGEVAGPRRFNMKMI
Download sequence
Identical sequences F7CLB4
ENSMODP00000037178 ENSMODP00000037178 13616.ENSMODP00000037178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]