SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037250 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037250
Domain Number 1 Region: 930-1027
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-18
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 116-195
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000345
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037250   Gene: ENSMODG00000002010   Transcript: ENSMODT00000038849
Sequence length 1172
Comment pep:novel chromosome:BROADO5:4:63048215:63344948:1 gene:ENSMODG00000002010 transcript:ENSMODT00000038849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSLVFLLLCGNIALTLGNAQKLPKGKKPSLKLHINTTGDSILMKFLRPDPNTKLEGFV
LGYGSNSQSNQYFPLPSEGKSSEAEVDAEPKYLIVVRPVPPPSQKKTCSGKSRTRKPLQM
VVGTLSPSSVFLSWGFLINPQYDWNLPSQCPNDRLYTVRYREKDKEKKWIFQICPATETV
VENLKPNTIYEFGVKDNLEDGLWSRIFNHKTIIGTKIKGNGKIQSTYDQTYTVPAYIPKK
IIPITVIRQVIQNVTHRAASKSPDRPSVGGTILVHLIIPGLNETVLKDPPPVMLDISETV
KTPLAKNETLAIPAESKTPEVEKIPAKPVTVTMETVRRTTNPAVTSVLEISERTLVVFLI
GSSKLFRITALPQMEKSITFDSPNRLPELPQAKTPPPLMKPRATLASDEIKWIASTTKTP
DGPKVLQPHTATYDTQPGFSSPPATEEPEISMTQTAATSHSTLDSDPSKTSRTIEQPRAP
LAPSEMPLLPQKPKTSPIPEIQHTTLAPKVTTMTRRPRTRPRPRPRPRPSPHPHPRPHLP
QTTTPTTEGPQNKPGKCTTLRPKLKTTPSPPVPQTKPVLESITSVPEPPMETIATTSLPS
KTLALTKPDVPQTKLATKPTTRAPPKTKQHNTHPFFSAPTSSRPVASKPKISPSPYASPT
LLAPRDVHKPGPDVSQTKPASTGTKDIPFKPKISPSPSQTVLQTTKAETSQSTQEPATTK
PPRPPKRIKTTQAPSKVYTTTVRRKLVKPGKNRTSGAGRPKPNGTSQDTGNDQNGILKPF
DASKNVSLDAIKKTAIITDTPHSTLPPPKPTQSRRKPLSPNNVTGKPGRPGTTLLPRVTT
PPPKVTFKPIGPTVPKKPETEKKQPTASVSGESDNFTDFSSSPTRETDSGGNQRFVAPHV
KYIPKPEDEPCSITDSVKRFPKEEVSEESPTSPPQNPPTNLTVVTVEGCSSFVILDWEKP
QNDTVTEYEIRSKENGAPTGKKEAIQTTNQTFSAIENLKPNTSYEFQVTPKNPLGEGPPS
KTVAFNTESADPRVSEPISAGRDAIWTEIPFNSDSYSECKGKQYVKRTWYKKFVGVQLCN
SLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLSSDQLPIKEGYFRAV
RQEPVQFGEIGGPTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences F7FXT3
ENSMODP00000037250 ENSMODP00000037250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]