SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037302 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037302
Domain Number 1 Region: 330-391,434-497
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000362
Family C1 set domains (antibody constant domain-like) 0.055
Further Details:      
 
Domain Number 2 Region: 30-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000908
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Domain Number 3 Region: 249-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000164
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 157-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000162
Family C2 set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037302   Gene: ENSMODG00000001829   Transcript: ENSMODT00000038901
Sequence length 582
Comment pep:novel chromosome:BROADO5:4:56529619:56772789:-1 gene:ENSMODG00000001829 transcript:ENSMODT00000038901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTAAHSCRLVLSLLISAAVLRPGLGLYTVNSVYGETIVMPCRLEVPQTLMFGKWKYEK
PDGSPVFIAFRSSTRKHVQYDEVPEYKDRLSLSENYTLSISHARISDEKRFVCMLVTEDN
VFEAPTVVKVFKQPSKPEIVNKAQFLETEQLKKLGDCVSKDSYPDVNITWYRNGKILDPS
EDMVTALRRQVDPATQLSTVTSSLTYKTTKNDIKIPFTCSVTYYGPSGQKTIHSDQAFFD
IYYPTEKVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQSEGIRSSNTYILT
DVRRNATGDYKCSLTDEKSMIAATTITVHYLDLSLNPSGEVTKQIGDALPVTCTISSSRN
ATVVWLKDNTKLRSRPSFSSLQYQDAGNYVCETNLQEVEGLKKRESLTLIVEGKPQIKMT
KKTDPNGLSKTITCHVEGFPKPAVQWTITGSGSVINQTEESPYVNGRYYSKIIISPEENV
TLTCTAENQLERTVNSLNVSAISIPEQDEADDISDENKEKVNDQAKLIVGIVVGLLLAAL
VAGIVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
Download sequence
Identical sequences F7CKB1
XP_016288914.1.35504 ENSMODP00000037302 ENSMODP00000037302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]