SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037486 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037486
Domain Number 1 Region: 79-497
Classification Level Classification E-value
Superfamily Sema domain 4.71e-92
Family Sema domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 500-539
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000129
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 559-626
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000335
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037486   Gene: ENSMODG00000025247   Transcript: ENSMODT00000039083
Sequence length 675
Comment pep:novel chromosome:BROADO5:1:22742632:22806282:-1 gene:ENSMODG00000025247 transcript:ENSMODT00000039083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPQQCPTRRPAPWPRLAALRAPRAGRLQDLPLQLSLLLLLLRAATPAVAAAAAVPAAA
SGSHPKTSPRITAAWKGQESYSFPQPEPHTVLYHEPGSDSVVVGGRGKLYHFDFIQGRNA
SIKTMDISPNKAFCQNQLDCENYITLLEKQREGLLICGTNARHPSCWNLSNRTISLLGER
RGYAPFTPDENSLVLFSDDQVYSTIRKQEYNGKIPRFRRIGGERELYTSDMVMQNPQFIK
ATIIQQDEAYNDKIYYFFRENNPDKNPEAPMNVSRVAQLCKGDQGGVSSMSASKWNTFLK
AMLVCSDPATNKNFNWLQDIFLVPNATGDWRSTRVYGVFSNPWKDLLNWGLRERDRGSDR
EWESQGGNKDLKEWMGRFREDLTPTETFQVADSHPEVAQRVEPFGAKKTPLFHSKYHYKK
VLVHQMQSRNGSTFDVLYLATDKGTIHKVVESDHGAFNIMEIQPFRHHPAIIQSMTLDST
TMKLYVNSQWEVSQVPLDLCSEYRGGCQGCLMARDPYCGWDDTNGQCVSIYKYKGPVLQS
LGPNEPHTECPSSKLGKSHSQDVTLARNSRYYLTCPVESHHATYSWHHGDKKVHRCEPGW
QNSDCILFIERLTDEQYGLYRCKAEEGSYSRIAVQWELRKEATAEHLLMGNDAGGLDAPV
CLRLLFALVVFLLFQ
Download sequence
Identical sequences F7F5Y8
ENSMODP00000037486 ENSMODP00000037486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]