SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037610 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037610
Domain Number 1 Region: 702-974
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.31e-51
Family WD40-repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 979-1251
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.24e-39
Family TehB-like 0.077
Further Details:      
 
Domain Number 3 Region: 25-134
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000172
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 138-191,253-298,392-492
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000458
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037610   Gene: ENSMODG00000003080   Transcript: ENSMODT00000039209
Sequence length 1610
Comment pep:novel chromosome:BROADO5:2:10768345:10797913:-1 gene:ENSMODG00000003080 transcript:ENSMODT00000039209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAWVFILVTCCLLLPSQATTHISSEDAQLLAEEPEPLRCFSREFEDLTCFWDEAEDKEP
GGGQDGEPYQLLFAYPGEEPQVCPLSAQRLPGGGLRHACQVQPADGLRLFAKLALWLWDP
ARAQNRTQRVLSVENVGLPAPPKSITAVTSGQTGELQVTWEVQPLEISDFMQHELQYGPV
DPSSSTQPTVTALLQAPTCCPFMRWPRQATPAQALQQHPTIEAPAIRGPAGPQWDGPPLL
KATREPSDLIGGSCIISGFQPGTSYWLQLRRKPDGISLKGFWGPWSSPVTVTLPQDAREI
GLHCFTQDLERVTCQREQGDTVRLETRFGHCSPCSCCGHGWGPAWEKCEKMDSREEETPV
TQCHFESQNDSAIHILVEITTEQGTIHQFLGTPFWMHQIVLTEAPQLQWTAGQGGQLKLS
WRPPLPWLPGKTHYQLRYSGQKHRHWKVLEPPRDALGEILELRPGAQYRLQLRARPDGPT
YYGPWSAWSVPALVEMAPDSGWVSVVTSAVLTLSFGGLVGLCLMLRRFFPARFRSGTMAQ
FVFENDLHSLLQLDTSIVNAPPARWQRKAKETPGPPPSPMRTANRSHSSSRTPGRTPGKS
SSKAQSTPSKAGGDRYIPHRSASQMEVASFLLSKENQPANHTPTRKEQQKAWSLNLNGFD
VEEAKILRLSGKPQNAPEGYQNSLRVLYSQKATPGSSRKKTCRYIPSLPDRILDAPEIRN
DYYLNLMDWSCGNVLAVALDTSVYLWSAGSGEILQLLQTERPGDYVSSVAWIKEGNYLAV
GTSSAEVQLWDVQQQKRLRNMSSHTARVGALSWNSYILSSGSRSGHVHHHDVRVAEHHVA
TLSGHSQEVCGLRWSPDGRYLASGGNDNLVNVWPSAPGDGGWAPLQTFTQHVGAVKAVAW
CPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAQSQVCAILWSPHYKELISGHGFAQN
QLVIWKYPSMAKVVPPKEWKPRSSYDDIDDLVIPAPIQQVVTGQSGLFTQYNIQKKAMTV
REFRRIANSDKYCTPRYNAFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLN
TILDVVENESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSIPPE
HGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPSILKKYGIPFDKVTQEAGQFMITFPYG
YHAGFNHGFNCAESTNFATLRWIEYGKQSVLCSCRKDMVKISMDVFVRKFQPERYKLWKA
GKDAPVIDHTLPTPEAAEFHKEEQQECPEEALDSNGGPAGEEAKKSLTKHRIGAKRHRVC
LEVPQEVSQSEAFAQREPYEMDGAFAPGKPCPDLVSPLRAENGALSSPDYPDSTEVKFEE
LKNVKLEDEDEEEAAALDLSLSGTANQASKKSRTRSETRSHRARRALAAHSCAQDDDSEQ
ELSEAAEEENQKAKGRRQPLSKLPRHHPLVAQECGSDDETVESLTPEEEAEETEAWAKPL
SQLWQNRPPNFEAERAYNESMALQPPHCAVCLIFQTYHQAEGGGHNQSWTSESDAEPGRR
RTKPLIPEMCFTATGCSTDLSLSTPYLEEDGTSILITCRKCSVCVHASEC
Download sequence
Identical sequences F6PL77
ENSMODP00000037610 ENSMODP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]