SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037751 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037751
Domain Number 1 Region: 36-133
Classification Level Classification E-value
Superfamily Fibronectin type III 2.14e-23
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 2 Region: 134-236
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000111
Family Fibronectin type III 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037751   Gene: ENSMODG00000021069   Transcript: ENSMODT00000039356
Sequence length 511
Comment pep:novel chromosome:BROADO5:4:14551585:14586665:-1 gene:ENSMODG00000021069 transcript:ENSMODT00000039356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNQHTLFIALQFFIPWELTHLMFSHALLEIPVQSCNLTMTSHNFQHILSWKSNSIATT
PIYYTVWYKIWSTVEEWKAVEDCTNITTLSCEITDFYEIRECYFINVTGFSGEEKLVECV
LNFFPISETILDPPEISIFNFKDAVNVTVHHPTFLSKLKEIEKDFFSSVVIKVESNGSSS
QDLEVEMADKENVTVTTDPLIPNSNYCISAQWKLVPSDKIQSSSKCFTFSPSQESEKSTL
IPVVFVVCFIIILLITTFVKTLKNTGYICRKPIPSPKALDFPPVTPGPLRLHYEKITVVE
IIYKIKKKEMLRESDDKSDNEDKSDSDYESTQRTGNGYIMNCLTSRSLSQDSTFTQKEGN
PTGSGPKDPECPETNPPLADAGSATSNQLKAGPDEKGVSRLWSFISEGSVLSSESEDCSN
FNVNLNTVFVGDPGDNNASEEDDAQILLPVQEDKTNLVDSDGSELLSQAACGKTPLLHVP
SAEHLWSENSSSDESVTSEPDKDQRGGYLRR
Download sequence
Identical sequences F6ZBD2
XP_007493333.1.35504 ENSMODP00000037751 ENSMODP00000037751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]