SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038011 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038011
Domain Number 1 Region: 45-378
Classification Level Classification E-value
Superfamily L domain-like 9.35e-59
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 428-521
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-19
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038011   Gene: ENSMODG00000025399   Transcript: ENSMODT00000039613
Sequence length 619
Comment pep:novel chromosome:BROADO5:1:6823743:6825602:1 gene:ENSMODG00000025399 transcript:ENSMODT00000039613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVRERMIAGDASMHSPILACWQPILLLVLGSVLSGSATGCPPRCECLPQERSVLCHRKR
FIAVPEGIPTETRLLDLGKNRIKTLNQDEFASYPHLEELELNENIVSAVEPGAFNNLFNL
RTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVY
ISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRL
KVLEISHWPYLDTMTSNCLYGLNLTSLSITHCNLTAIPYVSVRHLVYLRFLNLSYNPILS
IEGSLLHDLLRLQEIQLVGGQLATVEPYAFRGLNYLRILNVSGNQLTTLEESAFHSVGNL
ETLILDNNPLACDCRLLWVFRRRWRLNFNKQQPTCATPEFVQGKEFKDFPDVLLPNYFTC
RRARIRDRKPQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLISSKSNGRLTVFPDGT
LEVRYAQIQDNGTYLCIAANAGGNDSMLAHLHVRSYSPDWPHQPNKTFAFISNLPNESDA
NSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRK
SDAGISSADAPRKFNMKMI
Download sequence
Identical sequences F6RMM9
ENSMODP00000038011 ENSMODP00000038011 13616.ENSMODP00000038011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]