SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038018 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038018
Domain Number 1 Region: 53-256
Classification Level Classification E-value
Superfamily Fibronectin type III 2.01e-37
Family Fibronectin type III 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038018
Domain Number - Region: 1-41
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00149
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038018   Gene: ENSMODG00000025402   Transcript: ENSMODT00000039620
Sequence length 259
Comment pep:novel chromosome:BROADO5:7:17878570:18209554:1 gene:ENSMODG00000025402 transcript:ENSMODT00000039620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRPGFYKAFAGNIKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNV
IFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDANQCEVCGGGIRFIPRHTGLTNS
SVIVVDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGNVRKDWASQNS
IALSWQAPEFSNGAILDYEIKYYEKEHEQLSYSSTRSKAPSVIITGLKPATKYIFHIRVR
TAAGYSGYSQKFEFETGDE
Download sequence
Identical sequences F6RM90
ENSMODP00000038018 ENSMODP00000038018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]