SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038136 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038136
Domain Number 1 Region: 29-129
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-23
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038136   Gene: ENSMODG00000025427   Transcript: ENSMODT00000039736
Sequence length 131
Comment pep:novel chromosome:BROADO5:7:474108:718792:1 gene:ENSMODG00000025427 transcript:ENSMODT00000039736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLMLPQLLLCGLVCLHVYGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTP
TIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAM
SHNASLEVACK
Download sequence
Identical sequences F6W2X1
ENSMODP00000038136 ENSMODP00000038136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]