SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038219 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038219
Domain Number 1 Region: 22-111
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-25
Family I set domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038219   Gene: ENSMODG00000025444   Transcript: ENSMODT00000039819
Sequence length 111
Comment pep:novel chromosome:BROADO5:Un:43058450:43078990:-1 gene:ENSMODG00000025444 transcript:ENSMODT00000039819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLILYVSLCFTYVSYEQHNSFPRPSLKAENGSLVPQGGAVTLRCRGPWEAIQWHLLKNG
RSGHMGRGGNESEFSFPSVTANDAGTYQCQYRHSSYRWSERSDPLQLVVTG
Download sequence
Identical sequences H9H9Q7
ENSMODP00000038219 ENSMODP00000038219 13616.ENSMODP00000038219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]