SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038226 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038226
Domain Number 1 Region: 20-125
Classification Level Classification E-value
Superfamily Immunoglobulin 1.75e-17
Family V set domains (antibody variable domain-like) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038226   Gene: ENSMODG00000025450   Transcript: ENSMODT00000039826
Sequence length 282
Comment pep:novel chromosome:BROADO5:Un:9825182:9840337:1 gene:ENSMODG00000025450 transcript:ENSMODT00000039826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLLLLWGWIIIPGYGAMVGPKEVSGPEGSSLSVQCFYEDKHEENSKYWCKVTGLFFQR
CITIITTESGKEETDGKMSIMDNPQSRTFTVIMRNLTLKDAGQYQCGISRFGVDEVFEVT
VVVFSGLGSSVSPNPSLQSLSTRSVHRGAKVWGTRSPELSSRPSILLWKSEKCSPSLSPI
SSPLYPVPSPMSLCISPVPLSLPSPSPFPISHLLLPLPSPSFPLPFFSSLSSVPRPSIPL
IRILAPCIILLLLLVVVIATLLSFFSYFLNWRKEDVEIETSR
Download sequence
Identical sequences H9H9R3
13616.ENSMODP00000038226 ENSMODP00000038226 ENSMODP00000038226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]